SCOP 1.73: Domain d1qo0a_: 1qo0 A:

Lineage for d1qo0a_ (1qo0 A:)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   parallel beta-sheet of 6 strands, order 213456

4. Superfamily c.93.1: Periplasmic binding protein-like I [53822] (1 family)
   Similar in architecture to the superfamily II but partly differs in topology

5. Family c.93.1.1: L-arabinose binding protein-like [53823] (15 proteins)

6. Protein Amide receptor/negative regulator of the amidase operon (AmiC) [53833] (1 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [53834] (3 PDB entries)

8. Domain d1qo0a_: 1qo0 A: [35663]
   Other proteins in same PDB: d1qo0d_, d1qo0e_

Details for d1qo0a_

PDB Entry: 1qo0, 2.25 Å

PDB Description: amide receptor of the amidase operon of pseudomonas aeruginosa (amic) complexed with the negative regulator amir.

PDB Compounds: (A:) amic

SCOP Domain Sequences for d1qo0a_:

Sequence; same for both SEQRES and ATOM records:

>d1qo0a_ c.93.1.1 (A:) Amide receptor/negative regulator of the amidase operon (AmiC) {Pseudomonas aeruginosa [TaxId: 287]}
rpligllfsetgvtadiersqrygallaveqlnreggvggrpietlsqdpggdpdryrlc
aedfirnrgvrflvgcymshtrkavmpvveradallcyptpyegfeyspnivyggpapnq
nsaplaaylirhygervvfigsdyiypresnhvmrhlyrqhggtvleeiyiplypsdddl
qraveriyqaradvvfstvvgtgtaelyraiarrygdgrrppiaslttseaevakmesdv
aegqvvvapyfssidtpasrafvqachgffpenatitawaeaaywqtlllgraaqaagnw
rvedvqrhlydididapqgpvrverqnnhsrlssriaeidargvfqvrwqspepirpdpy
vvvhnlddwsasm

Timeline for d1qo0a_:

• d1qo0a_ first appeared (with stable ids) in SCOP 1.55
  
• d1qo0a_ appears in SCOP 1.71
  
• d1qo0a_ appears in SCOP 1.75
  
• d1qo0a_ appears in the current release, SCOPe 2.08