![]() | Class c: Alpha and beta proteins (a/b) [51349] (97 folds) |
![]() | Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily) |
![]() | Superfamily c.93.1: Periplasmic binding protein-like I [53822] (1 family) ![]() |
![]() | Family c.93.1.1: L-arabinose binding protein-like [53823] (12 proteins) |
![]() | Protein Amide receptor/negative regulator of the amidase operon (AmiC) [53833] (1 species) |
![]() | Species Pseudomonas aeruginosa [TaxId:287] [53834] (3 PDB entries) |
![]() | Domain d1qo0a_: 1qo0 A: [35663] Other proteins in same PDB: d1qo0d_, d1qo0e_ |
PDB Entry: 1qo0 (more details), 2.25 Å
SCOP Domain Sequences for d1qo0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qo0a_ c.93.1.1 (A:) Amide receptor/negative regulator of the amidase operon (AmiC) {Pseudomonas aeruginosa} rpligllfsetgvtadiersqrygallaveqlnreggvggrpietlsqdpggdpdryrlc aedfirnrgvrflvgcymshtrkavmpvveradallcyptpyegfeyspnivyggpapnq nsaplaaylirhygervvfigsdyiypresnhvmrhlyrqhggtvleeiyiplypsdddl qraveriyqaradvvfstvvgtgtaelyraiarrygdgrrppiaslttseaevakmesdv aegqvvvapyfssidtpasrafvqachgffpenatitawaeaaywqtlllgraaqaagnw rvedvqrhlydididapqgpvrverqnnhsrlssriaeidargvfqvrwqspepirpdpy vvvhnlddwsasm
Timeline for d1qo0a_: