Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (319 species) not a true protein |
Species Plasmodium falciparum [TaxId:36329] [225359] (7 PDB entries) |
Domain d6fqxg1: 6fqx G:1-175 [356627] Other proteins in same PDB: d6fqxa2, d6fqxb2, d6fqxc2, d6fqxd2, d6fqxe2, d6fqxf2, d6fqxg2, d6fqxh2 automated match to d2iz1a1 complexed with ae3, gol, peg, pge |
PDB Entry: 6fqx (more details), 2.8 Å
SCOPe Domain Sequences for d6fqxg1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6fqxg1 c.2.1.0 (G:1-175) automated matches {Plasmodium falciparum [TaxId: 36329]} mcdigliglavmgqnlslnisskgfkigvynrtyerteetmkrakeenlvvygyktveel innlkkprkvillikagpavdenisnilkhfekgdiiidggnewyinserriklckekdv eylamgvsggeagarygcsfmpggskyaydcvkeilekcsaqvgnspcvtyigpg
Timeline for d6fqxg1: