Lineage for d6ezea1 (6eze A:8-204)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2446887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2446888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2447791Family c.37.1.8: G proteins [52592] (80 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2448163Protein Elongation factor Tu (EF-Tu), N-terminal (G) domain [52626] (4 species)
  7. 2448170Species Escherichia coli [TaxId:562] [52627] (11 PDB entries)
    Uniprot P02990
  8. 3056559Domain d6ezea1: 6eze A:8-204 [356621]
    Other proteins in same PDB: d6ezea2, d6ezea3, d6ezeb2, d6ezeb3
    automated match to d1dg1g3
    complexed with gnp, gol, mg, peg, so4

Details for d6ezea1

PDB Entry: 6eze (more details), 2.47 Å

PDB Description: the open conformation of e.coli elongation factor tu in complex with gdpnp.
PDB Compounds: (A:) Elongation factor Tu 2

SCOPe Domain Sequences for d6ezea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ezea1 c.37.1.8 (A:8-204) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Escherichia coli [TaxId: 562]}
tkphvnvgtighvdhgkttltaaittvlaktyggaarafdqidnapeekargitintshv
eydtptrhyahvdcpghadyvknmitgaaqmdgailvvaatdgpmpqtrehillgrqvgv
pyiivflnkcdmvddeellelvemevrellsqydfpgddtpivrgsalkalegdaeweak
ilelagfldsyipeper

SCOPe Domain Coordinates for d6ezea1:

Click to download the PDB-style file with coordinates for d6ezea1.
(The format of our PDB-style files is described here.)

Timeline for d6ezea1:

  • d6ezea1 appears in periodic updates to SCOPe 2.07 starting on 2018-08-23