Lineage for d5uq9a2 (5uq9 A:178-470)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2721323Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. 2721324Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. 2721533Family a.100.1.0: automated matches [227147] (1 protein)
    not a true family
  6. 2721534Protein automated matches [226851] (46 species)
    not a true protein
  7. 2721650Species Human (Homo sapiens) [TaxId:9606] [225061] (28 PDB entries)
  8. 2721751Domain d5uq9a2: 5uq9 A:178-470 [356611]
    Other proteins in same PDB: d5uq9a1, d5uq9b1, d5uq9c1, d5uq9d1, d5uq9e1, d5uq9f1, d5uq9g1, d5uq9h1
    automated match to d2jkva2
    complexed with 8hs

Details for d5uq9a2

PDB Entry: 5uq9 (more details), 3 Å

PDB Description: crystal structure of 6-phosphogluconate dehydrogenase with ((4r,5r)-5- (hydroxycarbamoyl)-2,2-dimethyl-1,3-dioxolan-4-yl)methyl dihydrogen phosphate
PDB Compounds: (A:) 6-phosphogluconate dehydrogenase, decarboxylating

SCOPe Domain Sequences for d5uq9a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5uq9a2 a.100.1.0 (A:178-470) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gaghfvkmvhngieygdmqliceayhlmkdvlgmaqdemaqafedwnkteldsflieita
nilkfqdtdgkhllpkirdsagqkgtgkwtaisaleygvpvtligeavfarclsslkder
iqaskklkgpqkfqfdgdkksfledirkalyaskiisyaqgfmllrqaatefgwtlnygg
ialmwrggciirsvflgkikdafdrnpelqnlllddffksavencqdswrravstgvqag
ipmpcfttalsfydgyrhemlpasliqaqrdyfgahtyellakpgqfihtnwt

SCOPe Domain Coordinates for d5uq9a2:

Click to download the PDB-style file with coordinates for d5uq9a2.
(The format of our PDB-style files is described here.)

Timeline for d5uq9a2: