Lineage for d6ezeb3 (6eze B:297-393)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2386873Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2386874Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (2 families) (S)
    probably related to the second domain and its superfamiy by a circular permutation
  5. 2386875Family b.44.1.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50466] (7 proteins)
  6. 2386903Protein Elongation factor Tu (EF-Tu) [50467] (4 species)
  7. 2386910Species Escherichia coli [TaxId:562] [50468] (9 PDB entries)
    Uniprot P02990
  8. 3056544Domain d6ezeb3: 6eze B:297-393 [356606]
    Other proteins in same PDB: d6ezea1, d6ezea2, d6ezeb1, d6ezeb2
    automated match to d1dg1g2
    complexed with gnp, gol, mg, peg, so4

Details for d6ezeb3

PDB Entry: 6eze (more details), 2.47 Å

PDB Description: the open conformation of e.coli elongation factor tu in complex with gdpnp.
PDB Compounds: (B:) Elongation factor Tu 2

SCOPe Domain Sequences for d6ezeb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ezeb3 b.44.1.1 (B:297-393) Elongation factor Tu (EF-Tu) {Escherichia coli [TaxId: 562]}
tikphtkfesevyilskdeggrhtpffkgyrpqfyfrttdvtgtielpegvemvmpgdni
kmvvtlihpiamddglrfaireggrtvgagvvakvls

SCOPe Domain Coordinates for d6ezeb3:

Click to download the PDB-style file with coordinates for d6ezeb3.
(The format of our PDB-style files is described here.)

Timeline for d6ezeb3:

  • d6ezeb3 appears in periodic updates to SCOPe 2.07 starting on 2018-08-23