SCOPe 2.08: Domain d5zgqa_: 5zgq A:

Lineage for d5zgqa_ (5zgq A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
   duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets

4. Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (16 families)

5. Family d.157.1.0: automated matches [191360] (1 protein)
   not a true family

6. Protein automated matches [190418] (31 species)
   not a true protein

7. Species Klebsiella pneumoniae [TaxId:573] [189718] (103 PDB entries)

8. Domain d5zgqa_: 5zgq A: [356559]
   automated match to d4eyba_
   complexed with oh, zn, zz7

Details for d5zgqa_

PDB Entry: 5zgq, 1.5 Å

PDB Description: crystal structure of ndm-1 at ph7.5 (tris-hcl, (nh4)2so4) in complex with hydrolyzed ampicillin

PDB Compounds: (A:) Metallo-beta-lactamase type 2

SCOPe Domain Sequences for d5zgqa_:

Sequence; same for both SEQRES and ATOM records:

>d5zgqa_ d.157.1.0 (A:) automated matches {Klebsiella pneumoniae [TaxId: 573]}
eirptigqqmetgdqrfgdlvfrqlapnvwqhtsyldmpgfgavasnglivrdggrvlvv
dtawtddqtaqilnwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnqla
pqegmvaaqhsltfaangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggcl
ikdskakslgnlgdadtehyaasarafgaafpkasmivmshsapdsraaithtarmadkl
r

Timeline for d5zgqa_:

• d5zgqa_ first appeared in SCOPe 2.07