Lineage for d6h9sb2 (6h9s B:141-307)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2998746Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 2998747Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 2999522Family d.162.1.0: automated matches [227146] (1 protein)
    not a true family
  6. 2999523Protein automated matches [226850] (47 species)
    not a true protein
  7. 2999722Species Petrotoga mobilis [TaxId:403833] [356462] (1 PDB entry)
  8. 2999724Domain d6h9sb2: 6h9s B:141-307 [356551]
    Other proteins in same PDB: d6h9sa1, d6h9sb1
    automated match to d1hyha2
    complexed with nad

Details for d6h9sb2

PDB Entry: 6h9s (more details), 1.9 Å

PDB Description: crystal dimeric structure of petrotoga mobilis lactate dehydrogenase with nadh
PDB Compounds: (B:) l-lactate dehydrogenase

SCOPe Domain Sequences for d6h9sb2:

Sequence, based on SEQRES records: (download)

>d6h9sb2 d.162.1.0 (B:141-307) automated matches {Petrotoga mobilis [TaxId: 403833]}
gtildtarlraligkncgvspmsvhayiigehgdselaawssamiggvpikgfcrncpyk
dncnkdlskifddvknsaytiiskkgatnygiasattalvesiiknegrvytpsvllddv
yigypavinkdgvertiditlndeetekfessksiikeylesiknll

Sequence, based on observed residues (ATOM records): (download)

>d6h9sb2 d.162.1.0 (B:141-307) automated matches {Petrotoga mobilis [TaxId: 403833]}
gtildtarlraligkncgvspmsvhayiigehgdselaawssamiggvpikgfcdlskif
ddvknsaytiiskkgatnygiasattalvesiiknegrvytpsvllddvyigypavinkd
gvertiditlndeetekfessksiikeylesiknll

SCOPe Domain Coordinates for d6h9sb2:

Click to download the PDB-style file with coordinates for d6h9sb2.
(The format of our PDB-style files is described here.)

Timeline for d6h9sb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d6h9sb1