SCOPe 2.08: Domain d6h9sb1: 6h9s B:1-140

Lineage for d6h9sb1 (6h9s B:1-140)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (319 species)
   not a true protein

7. Species Petrotoga mobilis [TaxId:403833] [356460] (1 PDB entry)

8. Domain d6h9sb1: 6h9s B:1-140 [356550]
   Other proteins in same PDB: d6h9sa2, d6h9sb2
   automated match to d1hyha1
   complexed with nad

Details for d6h9sb1

PDB Entry: 6h9s, 1.9 Å

PDB Description: crystal dimeric structure of petrotoga mobilis lactate dehydrogenase with nadh

PDB Compounds: (B:) l-lactate dehydrogenase

SCOPe Domain Sequences for d6h9sb1:

Sequence, based on SEQRES records:

>d6h9sb1 c.2.1.0 (B:1-140) automated matches {Petrotoga mobilis [TaxId: 403833]}
mkisiigtgrvgsstafalinaavadeivlydlnkemaegealdllhattfhkrmiirag
eysdiegsdivlitagaaqkpgetrldltiknakiikgisenikkyapntliinitnpvd
vmsyvvwkvtgfesnrvigt

Sequence, based on observed residues (ATOM records):

>d6h9sb1 c.2.1.0 (B:1-140) automated matches {Petrotoga mobilis [TaxId: 403833]}
mkisiigtgrvgsstafalinaavadeivlydlnkemaegealdllhattfhkrmiirag
eysdiegsdivlitagaaetrldltiknakiikgisenikkyapntliinitnpvdvmsy
vvwkvtgfesnrvigt

Timeline for d6h9sb1:

• d6h9sb1 first appeared in SCOPe 2.07