Lineage for d1bap__ (1bap -)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily) Superfamily c.93.1: Periplasmic binding protein-like I [53822] (1 family) 
Family c.93.1.1: L-arabinose binding protein-like [53823] (12 proteins) Protein L-arabinose-binding protein [53826] (1 species) Species Escherichia coli [TaxId:562] [53827] (9 PDB entries) 
Domain d1bap__: 1bap - [35654]
Details for d1bap__
PDB Entry: 1bap (more details), 1.75 Å
PDB Description: a pro to gly mutation in the hinge of the arabinose-binding protein enhances binding and alters specificity: sugar-binding and crystallographic studies
SCOP Domain Sequences for d1bap__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bap__ c.93.1.1 (-) L-arabinose-binding protein {Escherichia coli}
nlklgflvkqpeepwfqtewkfadkagkdlgfevikiavpdgektlnaidslaasgakgf
victpdpklgsaivakargydmkviavddqfvnakgkpmdtvplvmmaatkigerqgqel
ykemqkrgwdvkesavmaitaneldtarrrttgsmdalkaagfpekqiyqvptksndipg
afdaansmlvqhpevkhwlivgmndstvlggvrategqgfkaadiigigingvdavsels
kaqatgfygsllgspdvhgykssemlynwvakdveppkftevtdvvlitrdnfkeelekk
glggk
SCOP Domain Coordinates for d1bap__:
Click to download the PDB-style file with coordinates for d1bap__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1bap__:
- d1bap__ appears in SCOP 1.57
- d1bap__ appears in the current release, SCOPe 2.08, called d1bapa_
View in 3D