Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.0: automated matches [191393] (1 protein) not a true family |
Protein automated matches [190509] (19 species) not a true protein |
Species Lactobacillus salivarius [TaxId:1624] [317238] (2 PDB entries) |
Domain d5y7pa1: 5y7p A:2-324 [356539] Other proteins in same PDB: d5y7pa2 automated match to d4wl3a_ complexed with chd, edo, gch, gol, peg, po4 |
PDB Entry: 5y7p (more details), 2.1 Å
SCOPe Domain Sequences for d5y7pa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5y7pa1 d.153.1.0 (A:2-324) automated matches {Lactobacillus salivarius [TaxId: 1624]} ctaitlngnsnyfgrnldldfsygeeviitpaeyefkfrkekaiknhksligvgivandy plyfdainedglgmaglnfpgnayysdalendkdnitpfefipwilgqcsdvnearnlve kinlinlsfseqlplaglhwliadreksivvevtksgvhiydnpigiltnnpefnyqmyn lnkyrnlsistpqntfsdsvdlkvdgtgfggiglpgdvspesrfvratfsklnsskgmtv eeditqffhilgtveqikgvnktesgkeeytvysncydldnktlyyttyenrqivavtln kdkdgnrlvtypferkqiinkln
Timeline for d5y7pa1: