Lineage for d5y7pa1 (5y7p A:2-324)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2995888Family d.153.1.0: automated matches [191393] (1 protein)
    not a true family
  6. 2995889Protein automated matches [190509] (19 species)
    not a true protein
  7. 2996425Species Lactobacillus salivarius [TaxId:1624] [317238] (2 PDB entries)
  8. 2996428Domain d5y7pa1: 5y7p A:2-324 [356539]
    Other proteins in same PDB: d5y7pa2
    automated match to d4wl3a_
    complexed with chd, edo, gch, gol, peg, po4

Details for d5y7pa1

PDB Entry: 5y7p (more details), 2.1 Å

PDB Description: bile salt hydrolase from lactobacillus salivarius complex with glycocholic acid and cholic acid
PDB Compounds: (A:) Bile salt hydrolase

SCOPe Domain Sequences for d5y7pa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5y7pa1 d.153.1.0 (A:2-324) automated matches {Lactobacillus salivarius [TaxId: 1624]}
ctaitlngnsnyfgrnldldfsygeeviitpaeyefkfrkekaiknhksligvgivandy
plyfdainedglgmaglnfpgnayysdalendkdnitpfefipwilgqcsdvnearnlve
kinlinlsfseqlplaglhwliadreksivvevtksgvhiydnpigiltnnpefnyqmyn
lnkyrnlsistpqntfsdsvdlkvdgtgfggiglpgdvspesrfvratfsklnsskgmtv
eeditqffhilgtveqikgvnktesgkeeytvysncydldnktlyyttyenrqivavtln
kdkdgnrlvtypferkqiinkln

SCOPe Domain Coordinates for d5y7pa1:

Click to download the PDB-style file with coordinates for d5y7pa1.
(The format of our PDB-style files is described here.)

Timeline for d5y7pa1: