Lineage for d6fqyb2 (6fqy B:176-468)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2721323Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. 2721324Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. 2721533Family a.100.1.0: automated matches [227147] (1 protein)
    not a true family
  6. 2721534Protein automated matches [226851] (46 species)
    not a true protein
  7. 2721881Species Plasmodium falciparum [TaxId:36329] [225360] (5 PDB entries)
  8. 2721901Domain d6fqyb2: 6fqy B:176-468 [356531]
    Other proteins in same PDB: d6fqya1, d6fqyb1
    automated match to d2iz1a2
    complexed with edo, nap

Details for d6fqyb2

PDB Entry: 6fqy (more details), 2.9 Å

PDB Description: plasmodium falciparum 6-phosphogluconate dehydrogenase in its apo form, in complex with its cofactor nadp+ and in complex with its substrate 6-phosphogluconate
PDB Compounds: (B:) 6-phosphogluconate dehydrogenase, decarboxylating

SCOPe Domain Sequences for d6fqyb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fqyb2 a.100.1.0 (B:176-468) automated matches {Plasmodium falciparum [TaxId: 36329]}
ssgnyvkmvhngieygdmqlisesyvimkhilkydnqklsevfnkwnegilnsylieita
nilakkddltnnylvdmildiagakgtgkwtmleatergipcptmcaaldarnisvfkel
rtkaesnfnkdnilidpnedlndfendllnalycckiisytqglfllkqvseemnwklnl
geiariwrggciiravfldrianayknneklellfldnefsddiknklpslrkivlmatk
ysipipafsaslayfqmvtsqnlplnlvqaqrdyfgshtyrrtdregnyhtlw

SCOPe Domain Coordinates for d6fqyb2:

Click to download the PDB-style file with coordinates for d6fqyb2.
(The format of our PDB-style files is described here.)

Timeline for d6fqyb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d6fqyb1