Lineage for d1apb__ (1apb -)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 28022Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
  4. 28023Superfamily c.93.1: Periplasmic binding protein-like I [53822] (1 family) (S)
  5. 28024Family c.93.1.1: L-arabinose binding protein-like [53823] (12 proteins)
  6. 28058Protein L-arabinose-binding protein [53826] (1 species)
  7. 28059Species Escherichia coli [TaxId:562] [53827] (9 PDB entries)
  8. 28066Domain d1apb__: 1apb - [35653]

Details for d1apb__

PDB Entry: 1apb (more details), 1.76 Å

PDB Description: a pro to gly mutation in the hinge of the arabinose-binding protein enhances binding and alters specificity: sugar-binding and crystallographic studies

SCOP Domain Sequences for d1apb__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1apb__ c.93.1.1 (-) L-arabinose-binding protein {Escherichia coli}
nlklgflvkqpeepwfqtewkfadkagkdlgfevikiavpdgektlnaidslaasgakgf
victpdpklgsaivakargydmkviavddqfvnakgkpmdtvplvmmaatkigerqgqel
ykemqkrgwdvkesavmaitaneldtarrrttgsmdalkaagfpekqiyqvptksndipg
afdaansmlvqhpevkhwlivgmndstvlggvrategqgfkaadiigigingvdavsels
kaqatgfygsllgspdvhgykssemlynwvakdveppkftevtdvvlitrdnfkeelekk
glggk

SCOP Domain Coordinates for d1apb__:

Click to download the PDB-style file with coordinates for d1apb__.
(The format of our PDB-style files is described here.)

Timeline for d1apb__: