Lineage for d6gx8a2 (6gx8 A:178-525)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2416558Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2418763Family c.1.8.13: Glycosyl hydrolase family 31 catalytic domain [117372] (5 proteins)
    Pfam PF01055
  6. 2418812Protein automated matches [310869] (3 species)
    not a true protein
  7. 3056389Species Thermotoga maritima [TaxId:243274] [356451] (5 PDB entries)
  8. 3056464Domain d6gx8a2: 6gx8 A:178-525 [356526]
    Other proteins in same PDB: d6gx8a1, d6gx8a3
    automated match to d1zy9a2
    complexed with fh2, gol, mg, so4

Details for d6gx8a2

PDB Entry: 6gx8 (more details), 1.42 Å

PDB Description: alpha-galactosidase from thermotoga maritima in complex with hydrolysed cyclohexene-based carbasugar mimic of galactose
PDB Compounds: (A:) alpha-galactosidase

SCOPe Domain Sequences for d6gx8a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6gx8a2 c.1.8.13 (A:178-525) automated matches {Thermotoga maritima [TaxId: 243274]}
rvpkhtptgwcswyhyfldltweetlknlklaknfpfevfqiddayekdigdwlvtrgdf
psveemakviaengfipgiwtapfsvsetsdvfnehpdwvvkengepkmayrnwnkkiya
ldlskdevlnwlfdlfsslrkmgyryfkidflfagavpgerkknitpiqafrkgietirk
avgedsfilgcgspllpavgcvdgmrigpdtapfwgehiedngapaarwalrnaitryfm
hdrfwlndpdclilreektdltqkekelysytcgvldnmiiesddlslvrdhgkkvlket
lellggrprvqnimsedlryeivssgtlsgnvkivvdlnsreyhleke

SCOPe Domain Coordinates for d6gx8a2:

Click to download the PDB-style file with coordinates for d6gx8a2.
(The format of our PDB-style files is described here.)

Timeline for d6gx8a2:

  • d6gx8a2 appears in periodic updates to SCOPe 2.07 starting on 2018-08-23