Class b: All beta proteins [48724] (180 folds) |
Fold b.30: Supersandwich [49993] (3 superfamilies) sandwich; 18 strands in 2 sheets |
Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) probable carbohydrate-binding domain in enzymes acting on sugars |
Family b.30.5.0: automated matches [227145] (1 protein) not a true family |
Protein automated matches [226849] (8 species) not a true protein |
Species Thermotoga maritima [TaxId:243274] [356449] (5 PDB entries) |
Domain d6gx8a1: 6gx8 A:1-177 [356525] Other proteins in same PDB: d6gx8a2, d6gx8a3 automated match to d1zy9a1 complexed with fh2, gol, mg, so4 |
PDB Entry: 6gx8 (more details), 1.42 Å
SCOPe Domain Sequences for d6gx8a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6gx8a1 b.30.5.0 (A:1-177) automated matches {Thermotoga maritima [TaxId: 243274]} meifgktfregrfvlkeknftvefavekihlgwkisgrvkgspgrlevlrtkapekvlvn nwqswgpcrvvdafsfkppeidpnwrytasvvpdvlernlqsdyfvaeegkvygflsski ahpffavedgelvayleyfdvefddfvpleplvvledpntplllekyaelvgmenna
Timeline for d6gx8a1: