SCOP 1.75: Domain d1abfa_: 1abf A:

Lineage for d1abfa_ (1abf A:)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   parallel beta-sheet of 6 strands, order 213456

4. Superfamily c.93.1: Periplasmic binding protein-like I [53822] (1 family)
   Similar in architecture to the superfamily II but partly differs in topology

5. Family c.93.1.1: L-arabinose binding protein-like [53823] (16 proteins)

6. Protein L-arabinose-binding protein [53826] (1 species)

7. Species Escherichia coli [TaxId:562] [53827] (9 PDB entries)

8. Domain d1abfa_: 1abf A: [35652]
   complexed with fca, fcb

Details for d1abfa_

PDB Entry: 1abf, 1.9 Å

PDB Description: substrate specificity and affinity of a protein modulated by bound water molecules

PDB Compounds: (A:) l-arabinose-binding protein

SCOP Domain Sequences for d1abfa_:

Sequence; same for both SEQRES and ATOM records:

>d1abfa_ c.93.1.1 (A:) L-arabinose-binding protein {Escherichia coli [TaxId: 562]}
nlklgflvkqpeepwfqtewkfadkagkdlgfevikiavpdgektlnaidslaasgakgf
victpdpklgsaivakargydmkviavddqfvnakgkpmdtvplvmmaatkigerqgqel
ykemqkrgwdvkesavmaitaneldtarrrttgsmdalkaagfpekqiyqvptksndipg
afdaansmlvqhpevkhwlivgmndstvlggvrategqgfkaadiigigingvdavsels
kaqatgfygsllpspdvhgykssemlynwvakdveppkftevtdvvlitrdnfkeelekk
glggk

Timeline for d1abfa_:

• d1abfa_ first appeared (with stable ids) in SCOP 1.55, called d1abf__
  
• d1abfa_ appears in SCOP 1.73
  
• d1abfa_ appears in SCOPe 2.01
  
• d1abfa_ appears in the current release, SCOPe 2.08