Lineage for d1abf__ (1abf -)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily) Superfamily c.93.1: Periplasmic binding protein-like I [53822] (1 family) 
Family c.93.1.1: L-arabinose binding protein-like [53823] (12 proteins) Protein L-arabinose-binding protein [53826] (1 species) Species Escherichia coli [TaxId:562] [53827] (9 PDB entries) 
Domain d1abf__: 1abf - [35652]
Details for d1abf__
PDB Entry: 1abf (more details), 1.9 Å
PDB Description: substrate specificity and affinity of a protein modulated by bound water molecules
SCOP Domain Sequences for d1abf__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1abf__ c.93.1.1 (-) L-arabinose-binding protein {Escherichia coli}
nlklgflvkqpeepwfqtewkfadkagkdlgfevikiavpdgektlnaidslaasgakgf
victpdpklgsaivakargydmkviavddqfvnakgkpmdtvplvmmaatkigerqgqel
ykemqkrgwdvkesavmaitaneldtarrrttgsmdalkaagfpekqiyqvptksndipg
afdaansmlvqhpevkhwlivgmndstvlggvrategqgfkaadiigigingvdavsels
kaqatgfygsllpspdvhgykssemlynwvakdveppkftevtdvvlitrdnfkeelekk
glggk
SCOP Domain Coordinates for d1abf__:
Click to download the PDB-style file with coordinates for d1abf__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1abf__:
- d1abf__ appears in SCOP 1.57
- d1abf__ appears in the current release, SCOPe 2.08, called d1abfa_
View in 3D