SCOPe 2.06: Domain d5abpa_: 5abp A:

Lineage for d5abpa_ (5abp A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   parallel beta-sheet of 6 strands, order 213456

4. Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families)
   Similar in architecture to the superfamily II but partly differs in topology

5. Family c.93.1.1: L-arabinose binding protein-like [53823] (18 proteins)

6. Protein L-arabinose-binding protein [53826] (1 species)

7. Species Escherichia coli [TaxId:562] [53827] (9 PDB entries)

8. Domain d5abpa_: 5abp A: [35651]
   complexed with gal, gla

Details for d5abpa_

PDB Entry: 5abp, 1.8 Å

PDB Description: substrate specificity and affinity of a protein modulated by bound water molecules

PDB Compounds: (A:) l-arabinose-binding protein

SCOPe Domain Sequences for d5abpa_:

Sequence; same for both SEQRES and ATOM records:

>d5abpa_ c.93.1.1 (A:) L-arabinose-binding protein {Escherichia coli [TaxId: 562]}
nlklgflvkqpeepwfqtewkfadkagkdlgfevikiavpdgektlnaidslaasgakgf
victpdpklgsaivakargydmkviavddqfvnakgkpmdtvplvmmaatkigerqgqel
ykemqkrgwdvkesavmaitaneldtarrrttgsmdalkaagfpekqiyqvptksndipg
afdaansmlvqhpevkhwlivgmndstvlggvrategqgfkaadiigigingvdavsels
kaqatgfygsllpspdvhgykssemlynwvakdveppkftevtdvvlitrdnfkeelekk
glggk

Timeline for d5abpa_:

• d5abpa_ first appeared (with stable ids) in SCOP 1.55, called d5abp__
  
• d5abpa_ appears in SCOPe 2.05
  
• d5abpa_ appears in SCOPe 2.07
  
• d5abpa_ appears in the current release, SCOPe 2.08