SCOPe 2.08: Domain d5uq9f1: 5uq9 F:2-177

Lineage for d5uq9f1 (5uq9 F:2-177)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (319 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186944] (65 PDB entries)

8. Domain d5uq9f1: 5uq9 F:2-177 [356502]
   Other proteins in same PDB: d5uq9a2, d5uq9b2, d5uq9c2, d5uq9d2, d5uq9e2, d5uq9f2, d5uq9g2, d5uq9h2
   automated match to d4gwga1
   complexed with 8hs

Details for d5uq9f1

PDB Entry: 5uq9, 3 Å

PDB Description: crystal structure of 6-phosphogluconate dehydrogenase with ((4r,5r)-5- (hydroxycarbamoyl)-2,2-dimethyl-1,3-dioxolan-4-yl)methyl dihydrogen phosphate

PDB Compounds: (F:) 6-phosphogluconate dehydrogenase, decarboxylating

SCOPe Domain Sequences for d5uq9f1:

Sequence; same for both SEQRES and ATOM records:

>d5uq9f1 c.2.1.0 (F:2-177) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aqadialiglavmgqnlilnmndhgfvvcafnrtvskvddflaneakgtkvvgaqslkem
vsklkkprriillvkagqavddfieklvplldtgdiiidggnseyrdttrrcrdlkakgi
lfvgsgvsggeegarygpslmpggnkeawphiktifqgiaakvgtgepccdwvgde

Timeline for d5uq9f1:

• d5uq9f1 first appeared in SCOPe 2.07