Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (319 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186944] (65 PDB entries) |
Domain d5uq9f1: 5uq9 F:2-177 [356502] Other proteins in same PDB: d5uq9a2, d5uq9b2, d5uq9c2, d5uq9d2, d5uq9e2, d5uq9f2, d5uq9g2, d5uq9h2 automated match to d4gwga1 complexed with 8hs |
PDB Entry: 5uq9 (more details), 3 Å
SCOPe Domain Sequences for d5uq9f1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5uq9f1 c.2.1.0 (F:2-177) automated matches {Human (Homo sapiens) [TaxId: 9606]} aqadialiglavmgqnlilnmndhgfvvcafnrtvskvddflaneakgtkvvgaqslkem vsklkkprriillvkagqavddfieklvplldtgdiiidggnseyrdttrrcrdlkakgi lfvgsgvsggeegarygpslmpggnkeawphiktifqgiaakvgtgepccdwvgde
Timeline for d5uq9f1: