Lineage for d6abp__ (6abp -)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 75160Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
  4. 75161Superfamily c.93.1: Periplasmic binding protein-like I [53822] (1 family) (S)
  5. 75162Family c.93.1.1: L-arabinose binding protein-like [53823] (12 proteins)
  6. 75200Protein L-arabinose-binding protein [53826] (1 species)
  7. 75201Species Escherichia coli [TaxId:562] [53827] (9 PDB entries)
  8. 75204Domain d6abp__: 6abp - [35650]

Details for d6abp__

PDB Entry: 6abp (more details), 1.67 Å

PDB Description: sugar-binding and crystallographic studies of an arabinose-binding protein mutant (met108leu) which exhibits enhanced affinity and altered specificity

SCOP Domain Sequences for d6abp__:

Sequence; same for both SEQRES and ATOM records: (download)

>d6abp__ c.93.1.1 (-) L-arabinose-binding protein {Escherichia coli}
nlklgflvkqpeepwfqtewkfadkagkdlgfevikiavpdgektlnaidslaasgakgf
victpdpklgsaivakargydmkviavddqfvnakgkpmdtvplvmlaatkigerqgqel
ykemqkrgwdvkesavmaitaneldtarrrttgsmdalkaagfpekqiyqvptksndipg
afdaansmlvqhpevkhwlivgmndstvlggvrategqgfkaadiigigingvdavsels
kaqatgfygsllpspdvhgykssemlynwvakdveppkftevtdvvlitrdnfkeelekk
glggk

SCOP Domain Coordinates for d6abp__:

Click to download the PDB-style file with coordinates for d6abp__.
(The format of our PDB-style files is described here.)

Timeline for d6abp__: