Class a: All alpha proteins [46456] (290 folds) |
Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily) multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry |
Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) N-terminal domain is Rossmann-fold with a family-specific C-terminal extension |
Family a.100.1.0: automated matches [227147] (1 protein) not a true family |
Protein automated matches [226851] (46 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225061] (28 PDB entries) |
Domain d5uq9c2: 5uq9 C:178-470 [356499] Other proteins in same PDB: d5uq9a1, d5uq9b1, d5uq9c1, d5uq9d1, d5uq9e1, d5uq9f1, d5uq9g1, d5uq9h1 automated match to d2jkva2 complexed with 8hs |
PDB Entry: 5uq9 (more details), 3 Å
SCOPe Domain Sequences for d5uq9c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5uq9c2 a.100.1.0 (C:178-470) automated matches {Human (Homo sapiens) [TaxId: 9606]} gaghfvkmvhngieygdmqliceayhlmkdvlgmaqdemaqafedwnkteldsflieita nilkfqdtdgkhllpkirdsagqkgtgkwtaisaleygvpvtligeavfarclsslkder iqaskklkgpqkfqfdgdkksfledirkalyaskiisyaqgfmllrqaatefgwtlnygg ialmwrggciirsvflgkikdafdrnpelqnlllddffksavencqdswrravstgvqag ipmpcfttalsfydgyrhemlpasliqaqrdyfgahtyellakpgqfihtnwt
Timeline for d5uq9c2: