SCOPe 2.07: Domain d6h0oa1: 6h0o A:4-271

Lineage for d6h0oa1 (6h0o A:4-271)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein automated matches [190091] (20 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188447] (892 PDB entries)

8. Domain d6h0oa1: 6h0o A:4-271 [356486]
   Other proteins in same PDB: d6h0oa2
   automated match to d2cl1a_
   complexed with f9n, gol

Details for d6h0oa1

PDB Entry: 6h0o, 2 Å

PDB Description: nek2 bound to purine inhibitor

PDB Compounds: (A:) serine/threonine-protein kinase nek2

SCOPe Domain Sequences for d6h0oa1:

Sequence, based on SEQRES records:

>d6h0oa1 d.144.1.7 (A:4-271) automated matches {Human (Homo sapiens) [TaxId: 9606]}
raedyevlytigtgsygrcqkirrksdgkilvwkeldygsmteaekqmlvsevnllrelk
hpnivryydriidrtnttlyivmeyceggdlasvitkgtkerqyldeefvlrvmtqltla
lkechrrsdgghtvlhrdlkpanvfldgkqnvklgdfglarilnhdtsfaktfvgtpyym
speqmnrmsyneksdiwslgcllyelcalmppftafsqkelagkiregkfrripyrysde
lneiitrmlnlkdyhrpsveeilenpli

Sequence, based on observed residues (ATOM records):

>d6h0oa1 d.144.1.7 (A:4-271) automated matches {Human (Homo sapiens) [TaxId: 9606]}
raedyevlytigtrcqkirrksdgkilvwkeldygslrelkhpnivryydriidrtnttl
yivmeyceggdlasvitkgtkerqyldeefvlrvmtqltlalkechrrlkpanvfldgkq
nvklgdfgtpyymspeqmnneksdiwslgcllyelcalmppftafsqkelagkiregkfr
ripyrysdelneiitrmlnlkdyhrpsveeilenpli

Timeline for d6h0oa1:

• d6h0oa1 is new in SCOPe 2.07-stable
  
• d6h0oa1 does not appear in SCOPe 2.08