SCOP 1.73: Domain d1abea_: 1abe A:

Lineage for d1abea_ (1abe A:)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   parallel beta-sheet of 6 strands, order 213456

4. Superfamily c.93.1: Periplasmic binding protein-like I [53822] (1 family)
   Similar in architecture to the superfamily II but partly differs in topology

5. Family c.93.1.1: L-arabinose binding protein-like [53823] (15 proteins)

6. Protein L-arabinose-binding protein [53826] (1 species)

7. Species Escherichia coli [TaxId:562] [53827] (9 PDB entries)

8. Domain d1abea_: 1abe A: [35648]
   complexed with ara, arb

Details for d1abea_

PDB Entry: 1abe, 1.7 Å

PDB Description: novel stereospecificity of the l-arabinose-binding protein

PDB Compounds: (A:) l-arabinose-binding protein

SCOP Domain Sequences for d1abea_:

Sequence; same for both SEQRES and ATOM records:

>d1abea_ c.93.1.1 (A:) L-arabinose-binding protein {Escherichia coli [TaxId: 562]}
nlklgflvkqpeepwfqtewkfadkagkdlgfevikiavpdgektlnaidslaasgakgf
victpdpklgsaivakargydmkviavddqfvnakgkpmdtvplvmmaatkigerqgqel
ykemqkrgwdvkesavmaitaneldtarrrttgsmdalkaagfpekqiyqvptksndipg
afdaansmlvqhpevkhwlivgmndstvlggvrategqgfkaadiigigingvdavsels
kaqatgfygsllpspdvhgykssemlynwvakdveppkftevtdvvlitrdnfkeelekk
glggk

Timeline for d1abea_:

• d1abea_ first appeared (with stable ids) in SCOP 1.55, called d1abe__
  
• d1abea_ was called d1abe__ in SCOP 1.71
  
• d1abea_ appears in SCOP 1.75
  
• d1abea_ appears in the current release, SCOPe 2.08