Lineage for d6gmqc_ (6gmq C:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2364769Fold b.3: Prealbumin-like [49451] (8 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2364948Superfamily b.3.3: VHL [49468] (1 family) (S)
    automatically mapped to Pfam PF01847
  5. 2364949Family b.3.3.1: VHL [49469] (2 proteins)
  6. 2364950Protein VHL [49470] (1 species)
  7. 2364951Species Human (Homo sapiens) [TaxId:9606] [49471] (38 PDB entries)
  8. 3056416Domain d6gmqc_: 6gmq C: [356478]
    Other proteins in same PDB: d6gmqa_, d6gmqb1, d6gmqb2, d6gmqd_, d6gmqe1, d6gmqe2, d6gmqg_, d6gmqh_, d6gmqj_, d6gmqk1, d6gmqk2
    automated match to d1lqbc_
    complexed with act, f4k, ipa

Details for d6gmqc_

PDB Entry: 6gmq (more details), 2.76 Å

PDB Description: pvhl:elob:eloc in complex with (4-(1h-pyrrol-1-yl)phenyl)methanol
PDB Compounds: (C:) von hippel-lindau disease tumor suppressor

SCOPe Domain Sequences for d6gmqc_:

Sequence, based on SEQRES records: (download)

>d6gmqc_ b.3.3.1 (C:) VHL {Human (Homo sapiens) [TaxId: 9606]}
lrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihsyrghlwlfrda
gthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslvkpenyrrldivr
slyedledhpnvqkdlerl

Sequence, based on observed residues (ATOM records): (download)

>d6gmqc_ b.3.3.1 (C:) VHL {Human (Homo sapiens) [TaxId: 9606]}
lrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihsyrghlwlfrda
gthdgllvnqtelfvpslnpifanitlpvytlkerclqvvrslvkpenyrrldivrslye
dledhpnvqkdlerl

SCOPe Domain Coordinates for d6gmqc_:

Click to download the PDB-style file with coordinates for d6gmqc_.
(The format of our PDB-style files is described here.)

Timeline for d6gmqc_: