Lineage for d6gmqh_ (6gmq H:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2513276Fold d.42: POZ domain [54694] (1 superfamily)
    core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143
  4. 2513277Superfamily d.42.1: POZ domain [54695] (3 families) (S)
  5. 2513278Family d.42.1.1: BTB/POZ domain [54696] (6 proteins)
  6. 2513355Protein Elongin C [54699] (3 species)
  7. 2513358Species Human (Homo sapiens) [TaxId:9606] [54700] (52 PDB entries)
  8. 3056405Domain d6gmqh_: 6gmq H: [356467]
    Other proteins in same PDB: d6gmqa_, d6gmqb2, d6gmqc_, d6gmqd_, d6gmqe2, d6gmqf_, d6gmqg_, d6gmqi_, d6gmqj_, d6gmqk2, d6gmql_
    automated match to d1lm8c_
    complexed with act, f4k, ipa

Details for d6gmqh_

PDB Entry: 6gmq (more details), 2.76 Å

PDB Description: pvhl:elob:eloc in complex with (4-(1h-pyrrol-1-yl)phenyl)methanol
PDB Compounds: (H:) Elongin-C

SCOPe Domain Sequences for d6gmqh_:

Sequence, based on SEQRES records: (download)

>d6gmqh_ d.42.1.1 (H:) Elongin C {Human (Homo sapiens) [TaxId: 9606]}
myvklissdghefivkrehaltsgtikamlsgpgqfaenetnevnfreipshvlskvcmy
ftykvrytnssteipefpiapeialellmaanfldc

Sequence, based on observed residues (ATOM records): (download)

>d6gmqh_ d.42.1.1 (H:) Elongin C {Human (Homo sapiens) [TaxId: 9606]}
myvklissdghefivkrehaltsgtikamlnevnfreipshvlskvcmyftykvrytnss
teipefpiapeialellmaanfldc

SCOPe Domain Coordinates for d6gmqh_:

Click to download the PDB-style file with coordinates for d6gmqh_.
(The format of our PDB-style files is described here.)

Timeline for d6gmqh_:

  • d6gmqh_ appears in periodic updates to SCOPe 2.07 starting on 2018-08-23