Lineage for d6h9sa1 (6h9s A:1-140)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2426096Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2426097Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2430344Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2430345Protein automated matches [190069] (259 species)
    not a true protein
  7. 3056398Species Petrotoga mobilis [TaxId:403833] [356460] (1 PDB entry)
  8. 3056399Domain d6h9sa1: 6h9s A:1-140 [356461]
    Other proteins in same PDB: d6h9sa2, d6h9sb2
    automated match to d1hyha1
    complexed with nad

Details for d6h9sa1

PDB Entry: 6h9s (more details), 1.9 Å

PDB Description: crystal dimeric structure of petrotoga mobilis lactate dehydrogenase with nadh
PDB Compounds: (A:) l-lactate dehydrogenase

SCOPe Domain Sequences for d6h9sa1:

Sequence, based on SEQRES records: (download)

>d6h9sa1 c.2.1.0 (A:1-140) automated matches {Petrotoga mobilis [TaxId: 403833]}
mkisiigtgrvgsstafalinaavadeivlydlnkemaegealdllhattfhkrmiirag
eysdiegsdivlitagaaqkpgetrldltiknakiikgisenikkyapntliinitnpvd
vmsyvvwkvtgfesnrvigt

Sequence, based on observed residues (ATOM records): (download)

>d6h9sa1 c.2.1.0 (A:1-140) automated matches {Petrotoga mobilis [TaxId: 403833]}
mkisiigtgrvgsstafalinaavadeivlydlnkemaegealdllhattfhkrmiirag
eysdiegsdivlitagaatrldltiknakiikgisenikkyapntliinitnpvdvmsyv
vwkvtgfesnrvigt

SCOPe Domain Coordinates for d6h9sa1:

Click to download the PDB-style file with coordinates for d6h9sa1.
(The format of our PDB-style files is described here.)

Timeline for d6h9sa1:

  • d6h9sa1 appears in periodic updates to SCOPe 2.07 starting on 2018-08-23

View in 3D
Domains from same chain:
(mouse over for more information)
d6h9sa2