Lineage for d6gvda1 (6gvd A:1-177)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2375752Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 2375891Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) (S)
    probable carbohydrate-binding domain in enzymes acting on sugars
  5. 2376363Family b.30.5.0: automated matches [227145] (1 protein)
    not a true family
  6. 2376364Protein automated matches [226849] (8 species)
    not a true protein
  7. 3056387Species Thermotoga maritima [TaxId:243274] [356449] (5 PDB entries)
  8. 3056392Domain d6gvda1: 6gvd A:1-177 [356454]
    Other proteins in same PDB: d6gvda2, d6gvda3
    automated match to d1zy9a1
    complexed with fdk, mg, so4

Details for d6gvda1

PDB Entry: 6gvd (more details), 1.22 Å

PDB Description: alpha-galactosidase from thermotoga maritima in complex with cyclohexene-based carbasugar mimic of galactose
PDB Compounds: (A:) alpha-galactosidase

SCOPe Domain Sequences for d6gvda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6gvda1 b.30.5.0 (A:1-177) automated matches {Thermotoga maritima [TaxId: 243274]}
meifgktfregrfvlkeknftvefavekihlgwkisgrvkgspgrlevlrtkapekvlvn
nwqswgpcrvvdafsfkppeidpnwrytasvvpdvlernlqsdyfvaeegkvygflsski
ahpffavedgelvayleyfdvefddfvpleplvvledpntplllekyaelvgmenna

SCOPe Domain Coordinates for d6gvda1:

Click to download the PDB-style file with coordinates for d6gvda1.
(The format of our PDB-style files is described here.)

Timeline for d6gvda1:

  • d6gvda1 appears in periodic updates to SCOPe 2.07 starting on 2018-08-23