Lineage for d6cqpb2 (6cqp B:285-495)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2869013Family c.37.1.10: Nitrogenase iron protein-like [52652] (16 proteins)
    core: parallel beta-sheet of 7 strands; order 3241567
  6. 2869314Protein automated matches [190304] (16 species)
    not a true protein
  7. 2869338Species Escherichia coli [TaxId:83333] [356353] (9 PDB entries)
  8. 2869344Domain d6cqpb2: 6cqp B:285-495 [356412]
    Other proteins in same PDB: d6cqpa1, d6cqpa3, d6cqpb1, d6cqpb3
    automated match to d2qy9a2
    complexed with gol, na

Details for d6cqpb2

PDB Entry: 6cqp (more details), 1.45 Å

PDB Description: high resolution crystal structure of ftsy-ng domain of e. coli
PDB Compounds: (B:) signal recognition particle receptor ftsy

SCOPe Domain Sequences for d6cqpb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6cqpb2 c.37.1.10 (B:285-495) automated matches {Escherichia coli [TaxId: 83333]}
plnvegkapfvilmvgvngvgktttigklarqfeqqgksvmlaagdtfraaaveqlqvwg
qrnnipviaqhtgadsasvifdaiqaakarnidvliadtagrlqnkshlmeelkkivrvm
kkldveaphevmltidastgqnavsqaklfheavgltgitltkldgtakggvifsvadqf
gipiryigvgeriedlrpfkaddfiealfar

SCOPe Domain Coordinates for d6cqpb2:

Click to download the PDB-style file with coordinates for d6cqpb2.
(The format of our PDB-style files is described here.)

Timeline for d6cqpb2: