Lineage for d6drvb5 (6drv B:732-1024)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2375752Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 2375891Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) (S)
    probable carbohydrate-binding domain in enzymes acting on sugars
  5. 2376363Family b.30.5.0: automated matches [227145] (1 protein)
    not a true family
  6. 2376364Protein automated matches [226849] (8 species)
    not a true protein
  7. 2376447Species Escherichia coli [TaxId:83333] [272144] (3 PDB entries)
  8. 3056343Domain d6drvb5: 6drv B:732-1024 [356405]
    Other proteins in same PDB: d6drva1, d6drva2, d6drva3, d6drva4, d6drvb1, d6drvb2, d6drvb3, d6drvb4, d6drvc1, d6drvc2, d6drvc3, d6drvc4
    automated match to d1jz8a4

Details for d6drvb5

PDB Entry: 6drv (more details), 2.2 Å

PDB Description: beta-galactosidase
PDB Compounds: (B:) beta-galactosidase

SCOPe Domain Sequences for d6drvb5:

Sequence; same for both SEQRES and ATOM records: (download)

>d6drvb5 b.30.5.0 (B:732-1024) automated matches {Escherichia coli [TaxId: 83333]}
paashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapld
ndigvseatridpnawverwkaaghyqaeaallqctadtladavlittahawqhqgktlf
isrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgpqenypdrl
taacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqqqlmet
shrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcqk

SCOPe Domain Coordinates for d6drvb5:

Click to download the PDB-style file with coordinates for d6drvb5.
(The format of our PDB-style files is described here.)

Timeline for d6drvb5: