Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.0: automated matches [191359] (1 protein) not a true family |
Protein automated matches [190417] (37 species) not a true protein |
Species Maize (Zea mays) [TaxId:4577] [350332] (3 PDB entries) |
Domain d6easa_: 6eas A: [356373] automated match to d4yfia_ complexed with gol, j3a |
PDB Entry: 6eas (more details), 2 Å
SCOPe Domain Sequences for d6easa_:
Sequence, based on SEQRES records: (download)
>d6easa_ d.144.1.0 (A:) automated matches {Maize (Zea mays) [TaxId: 4577]} afvtgvpslkrseletacedfsniigststcmlykgtlssgveiavasslvtsakdwske nesqyrkkitnlskvshknfmnllgyceeehpftrvmvfeyapngtlfehlhvreaekld wmarlrismgiayclehmhqlqtpaalrnfdsttvyltddfaakvsdlefwndakghnst tnnelafspdmedivrkygmvlleiltgrvpsseddgplenwvsryfeggmrleelidps igffpedtaralcevvrscidrdpkkrpqmkevaarmreitalgp
>d6easa_ d.144.1.0 (A:) automated matches {Maize (Zea mays) [TaxId: 4577]} afvtgvpslkrseletacedfsniigststcmlykgtlssgveiavasslvtsakdwske nesqyrkkitnlskvshknfmnllgyceeehpftrvmvfeyapngtlfehlhvreaekld wmarlrismgiayclehmhqlqtpaalrnfdsttvyltddfaakvsdlefwnpdmedivr kygmvlleiltgrvpslenwvsryfeggmrleelidpsigffpedtaralcevvrscidr dpkkrpqmkevaarmreitalgp
Timeline for d6easa_: