Lineage for d2dria_ (2dri A:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 710422Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 710423Superfamily c.93.1: Periplasmic binding protein-like I [53822] (1 family) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 710424Family c.93.1.1: L-arabinose binding protein-like [53823] (15 proteins)
  6. 710441Protein D-ribose-binding protein [53824] (1 species)
  7. 710442Species Escherichia coli, strain k-12 [TaxId:562] [53825] (6 PDB entries)
  8. 710443Domain d2dria_: 2dri A: [35637]
    complexed with rip

Details for d2dria_

PDB Entry: 2dri (more details), 1.6 Å

PDB Description: probing protein-protein interactions: the ribose binding protein in bacterial transport and chemotaxis
PDB Compounds: (A:) d-ribose-binding protein

SCOP Domain Sequences for d2dria_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dria_ c.93.1.1 (A:) D-ribose-binding protein {Escherichia coli, strain k-12 [TaxId: 562]}
kdtialvvstlnnpffvslkdgaqkeadklgynlvvldsqnnpakelanvqdltvrgtki
llinptdsdavgnavkmanqanipvitldrqatkgevvshiasdnvlggkiagdyiakka
gegakvielqgiagtsaarergegfqqavaahkfnvlasqpadfdrikglnvmqnlltah
pdvqavfaqndemalgalralqtagksdvmvvgfdgtpdgekavndgklaatiaqlpdqi
gakgvetadkvlkgekvqakypvdlklvvkq

SCOP Domain Coordinates for d2dria_:

Click to download the PDB-style file with coordinates for d2dria_.
(The format of our PDB-style files is described here.)

Timeline for d2dria_: