Lineage for d5z85w_ (5z85 W:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2630215Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2630532Superfamily f.23.4: Mitochondrial cytochrome c oxidase subunit VIIa [81419] (1 family) (S)
    automatically mapped to Pfam PF02238
  5. 2630533Family f.23.4.1: Mitochondrial cytochrome c oxidase subunit VIIa [81418] (2 proteins)
  6. 2630534Protein Mitochondrial cytochrome c oxidase subunit VIIa [81417] (1 species)
    function unknown, probably acts as a regulator or is required for the assembly
  7. 2630535Species Cow (Bos taurus) [TaxId:9913] [81416] (51 PDB entries)
  8. 2630590Domain d5z85w_: 5z85 W: [356299]
    Other proteins in same PDB: d5z85a_, d5z85b1, d5z85b2, d5z85c_, d5z85d_, d5z85e_, d5z85f_, d5z85g_, d5z85h_, d5z85i_, d5z85k_, d5z85l_, d5z85m_, d5z85o1, d5z85o2, d5z85p_, d5z85q_, d5z85s_, d5z85t_, d5z85u_, d5z85v_, d5z85x_, d5z85y_, d5z85z_
    automated match to d3ag3j_
    complexed with azi, cdl, chd, cu, cua, dmu, edo, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d5z85w_

PDB Entry: 5z85 (more details), 1.85 Å

PDB Description: the structure of azide-bound cytochrome c oxidase determined using the another batch crystals exposed to 20 mm azide solution for 2 days
PDB Compounds: (W:) cytochrome c oxidase subunit 7a1, mitochondrial

SCOPe Domain Sequences for d5z85w_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5z85w_ f.23.4.1 (W:) Mitochondrial cytochrome c oxidase subunit VIIa {Cow (Bos taurus) [TaxId: 9913]}
fenrvaekqklfqednglpvhlkggatdnilyrvtmtlclggtlyslyclgwasfphk

SCOPe Domain Coordinates for d5z85w_:

Click to download the PDB-style file with coordinates for d5z85w_.
(The format of our PDB-style files is described here.)

Timeline for d5z85w_: