![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.51: Cytochrome c oxidase subunit h [47693] (1 superfamily) 4 helices; irregular array, disulfide-linked |
![]() | Superfamily a.51.1: Cytochrome c oxidase subunit h [47694] (2 families) ![]() |
![]() | Family a.51.1.1: Cytochrome c oxidase subunit h [47695] (2 proteins) |
![]() | Protein automated matches [190271] (1 species) not a true protein |
![]() | Species Cow (Bos taurus) [TaxId:9913] [187063] (26 PDB entries) |
![]() | Domain d5z84u_: 5z84 U: [356293] Other proteins in same PDB: d5z84a_, d5z84b1, d5z84b2, d5z84c_, d5z84d_, d5z84e_, d5z84f_, d5z84g_, d5z84i_, d5z84j_, d5z84k_, d5z84l_, d5z84m_, d5z84n_, d5z84o1, d5z84o2, d5z84p_, d5z84q_, d5z84r_, d5z84s_, d5z84t_, d5z84v_, d5z84w_, d5z84x_, d5z84y_, d5z84z_ automated match to d1v54h_ complexed with azi, cdl, chd, cu, cua, dmu, edo, hea, mg, na, pek, pgv, psc, tgl, unx, zn |
PDB Entry: 5z84 (more details), 1.85 Å
SCOPe Domain Sequences for d5z84u_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5z84u_ a.51.1.1 (U:) automated matches {Cow (Bos taurus) [TaxId: 9913]} kiknyqtapfdsrfpnqnqtrncwqnyldfhrcekamtakggdvsvcewyrrvykslcpi swvstwddrraegtfpgki
Timeline for d5z84u_:
![]() Domains from other chains: (mouse over for more information) d5z84a_, d5z84b1, d5z84b2, d5z84c_, d5z84d_, d5z84e_, d5z84f_, d5z84g_, d5z84h_, d5z84i_, d5z84j_, d5z84k_, d5z84l_, d5z84m_, d5z84n_, d5z84o1, d5z84o2, d5z84p_, d5z84q_, d5z84r_, d5z84s_, d5z84t_, d5z84v_, d5z84w_, d5z84x_, d5z84y_, d5z84z_ |