Lineage for d5zcqn_ (5zcq N:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2632295Fold f.24: Cytochrome c oxidase subunit I-like [81443] (1 superfamily)
    12 transmembrane helices in an approximate threefold rotational symmetric arrangement
  4. 2632296Superfamily f.24.1: Cytochrome c oxidase subunit I-like [81442] (1 family) (S)
  5. 2632297Family f.24.1.1: Cytochrome c oxidase subunit I-like [81441] (5 proteins)
    the largest and best conserved subunit, contains two heme groups, low spin heme a and high spin heme a3
  6. 2632350Protein Mitochondrial cytochrome c oxidase, subunit I [81433] (1 species)
  7. 2632351Species Cow (Bos taurus) [TaxId:9913] [81432] (35 PDB entries)
  8. 2632363Domain d5zcqn_: 5zcq N: [356287]
    Other proteins in same PDB: d5zcqd_, d5zcqe_, d5zcqg_, d5zcqh_, d5zcqi_, d5zcqj_, d5zcqk_, d5zcql_, d5zcqm_, d5zcqq_, d5zcqr_
    automated match to d1v54a_
    complexed with azi, cdl, chd, cu, cua, dmu, edo, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d5zcqn_

PDB Entry: 5zcq (more details), 1.65 Å

PDB Description: azide-bound cytochrome c oxidase structure determined using the crystals exposed to 10 mm azide solution for 2 days
PDB Compounds: (N:) Cytochrome c oxidase subunit 1

SCOPe Domain Sequences for d5zcqn_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5zcqn_ f.24.1.1 (N:) Mitochondrial cytochrome c oxidase, subunit I {Cow (Bos taurus) [TaxId: 9913]}
mfinrwlfstnhkdigtlyllfgawagmvgtalslliraelgqpgtllgddqiynvvvta
hafvmiffmvmpimiggfgnwlvplmigapdmafprmnnmsfwllppsfllllassmvea
gagtgwtvypplagnlahagasvdltifslhlagvssilgainfittiinmkppamsqyq
tplfvwsvmitavllllslpvlaagitmlltdrnlnttffdpagggdpilyqhlfwffgh
pevyililpgfgmishivtyysgkkepfgymgmvwammsigflgfivwahhmftvgmdvd
trayftsatmiiaiptgvkvfswlatlhggnikwspammwalgfiflftvggltgivlan
ssldivlhdtyyvvahfhyvlsmgavfaimggfvhwfplfsgytlndtwakihfaimfvg
vnmtffpqhflglsgmprrysdypdaytmwntissmgsfisltavmlmvfiiweafaskr
evltvdltttnlewlngcpppyhtfeeptyvnlk

SCOPe Domain Coordinates for d5zcqn_:

Click to download the PDB-style file with coordinates for d5zcqn_.
(The format of our PDB-style files is described here.)

Timeline for d5zcqn_: