![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
![]() | Superfamily f.23.5: Mitochondrial cytochrome c oxidase subunit VIIb [81423] (1 family) ![]() automatically mapped to Pfam PF05392 |
![]() | Family f.23.5.1: Mitochondrial cytochrome c oxidase subunit VIIb [81422] (2 proteins) |
![]() | Protein automated matches [190272] (1 species) not a true protein |
![]() | Species Cow (Bos taurus) [TaxId:9913] [187064] (26 PDB entries) |
![]() | Domain d5z85x_: 5z85 X: [356243] Other proteins in same PDB: d5z85a_, d5z85b1, d5z85b2, d5z85c_, d5z85d_, d5z85e_, d5z85f_, d5z85g_, d5z85h_, d5z85i_, d5z85j_, d5z85l_, d5z85m_, d5z85n_, d5z85o1, d5z85o2, d5z85p_, d5z85q_, d5z85r_, d5z85s_, d5z85t_, d5z85u_, d5z85v_, d5z85w_, d5z85y_, d5z85z_ automated match to d1v54k_ complexed with azi, cdl, chd, cu, cua, dmu, edo, hea, mg, na, pek, pgv, psc, tgl, unx, zn |
PDB Entry: 5z85 (more details), 1.85 Å
SCOPe Domain Sequences for d5z85x_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5z85x_ f.23.5.1 (X:) automated matches {Cow (Bos taurus) [TaxId: 9913]} apdfhdkygnavlasgatfcvavwvymatqigiewnpspvgrvtpkewr
Timeline for d5z85x_:
![]() Domains from other chains: (mouse over for more information) d5z85a_, d5z85b1, d5z85b2, d5z85c_, d5z85d_, d5z85e_, d5z85f_, d5z85g_, d5z85h_, d5z85i_, d5z85j_, d5z85k_, d5z85l_, d5z85m_, d5z85n_, d5z85o1, d5z85o2, d5z85p_, d5z85q_, d5z85r_, d5z85s_, d5z85t_, d5z85u_, d5z85v_, d5z85w_, d5z85y_, d5z85z_ |