Lineage for d5z84b2 (5z84 B:91-227)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2366402Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2366403Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2366998Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (3 proteins)
  6. 2367137Protein automated matches [233094] (2 species)
    not a true protein
  7. 2367138Species Cow (Bos taurus) [TaxId:9913] [255752] (7 PDB entries)
  8. 3056180Domain d5z84b2: 5z84 B:91-227 [356242]
    Other proteins in same PDB: d5z84a_, d5z84b1, d5z84c_, d5z84d_, d5z84e_, d5z84f_, d5z84g_, d5z84h_, d5z84i_, d5z84j_, d5z84k_, d5z84l_, d5z84m_, d5z84n_, d5z84o1, d5z84p_, d5z84q_, d5z84r_, d5z84s_, d5z84t_, d5z84u_, d5z84v_, d5z84w_, d5z84x_, d5z84y_, d5z84z_
    automated match to d3ag3b2
    complexed with azi, cdl, chd, cu, cua, dmu, edo, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d5z84b2

PDB Entry: 5z84 (more details), 1.85 Å

PDB Description: the structure of azide-bound cytochrome c oxidase determined using the crystals exposed to 20 mm azide solution for 4 days
PDB Compounds: (B:) Cytochrome c oxidase subunit 2

SCOPe Domain Sequences for d5z84b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5z84b2 b.6.1.2 (B:91-227) automated matches {Cow (Bos taurus) [TaxId: 9913]}
nnpsltvktmghqwywsyeytdyedlsfdsymiptselkpgelrllevdnrvvlpmemti
rmlvssedvlhswavpslglktdaipgrlnqttlmssrpglyygqcseicgsnhsfmpiv
lelvplkyfekwsasml

SCOPe Domain Coordinates for d5z84b2:

Click to download the PDB-style file with coordinates for d5z84b2.
(The format of our PDB-style files is described here.)

Timeline for d5z84b2:

  • d5z84b2 appears in periodic updates to SCOPe 2.07 starting on 2018-08-16