SCOPe 2.08: Domain d5z84b2: 5z84 B:91-227

Lineage for d5z84b2 (5z84 B:91-227)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (3 proteins)

6. Protein automated matches [233094] (2 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [255752] (7 PDB entries)

8. Domain d5z84b2: 5z84 B:91-227 [356242]
   Other proteins in same PDB: d5z84a_, d5z84b1, d5z84c_, d5z84d_, d5z84e_, d5z84f_, d5z84g_, d5z84h_, d5z84i_, d5z84j_, d5z84k_, d5z84l_, d5z84m_, d5z84n_, d5z84o1, d5z84p_, d5z84q_, d5z84r_, d5z84s_, d5z84t_, d5z84u_, d5z84v_, d5z84w_, d5z84x_, d5z84y_, d5z84z_
   automated match to d3ag3b2
   complexed with azi, cdl, chd, cu, cua, dmu, edo, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d5z84b2

PDB Entry: 5z84, 1.85 Å

PDB Description: the structure of azide-bound cytochrome c oxidase determined using the crystals exposed to 20 mm azide solution for 4 days

PDB Compounds: (B:) Cytochrome c oxidase subunit 2

SCOPe Domain Sequences for d5z84b2:

Sequence; same for both SEQRES and ATOM records:

>d5z84b2 b.6.1.2 (B:91-227) automated matches {Cow (Bos taurus) [TaxId: 9913]}
nnpsltvktmghqwywsyeytdyedlsfdsymiptselkpgelrllevdnrvvlpmemti
rmlvssedvlhswavpslglktdaipgrlnqttlmssrpglyygqcseicgsnhsfmpiv
lelvplkyfekwsasml

Timeline for d5z84b2:

• d5z84b2 first appeared in SCOPe 2.07