Lineage for d5zcpo2 (5zcp O:91-227)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2380192Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2380193Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2380835Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (3 proteins)
  6. 2380999Protein automated matches [233094] (2 species)
    not a true protein
  7. 2381000Species Cow (Bos taurus) [TaxId:9913] [255752] (7 PDB entries)
  8. 2381002Domain d5zcpo2: 5zcp O:91-227 [356233]
    Other proteins in same PDB: d5zcpa_, d5zcpb1, d5zcpc_, d5zcpd_, d5zcpe_, d5zcpf_, d5zcpg_, d5zcph_, d5zcpi_, d5zcpj_, d5zcpk_, d5zcpl_, d5zcpm_, d5zcpn_, d5zcpo1, d5zcpp_, d5zcpq_, d5zcpr_, d5zcps_, d5zcpt_, d5zcpu_, d5zcpv_, d5zcpw_, d5zcpx_, d5zcpy_, d5zcpz_
    automated match to d3ag3b2
    complexed with azi, cdl, chd, cu, cua, dmu, edo, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d5zcpo2

PDB Entry: 5zcp (more details), 1.65 Å

PDB Description: azide-bound cytochrome c oxidase structure determined using the crystals exposed to 20 mm azide solution for 2 days
PDB Compounds: (O:) Cytochrome c oxidase subunit 2

SCOPe Domain Sequences for d5zcpo2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5zcpo2 b.6.1.2 (O:91-227) automated matches {Cow (Bos taurus) [TaxId: 9913]}
nnpsltvktmghqwywsyeytdyedlsfdsymiptselkpgelrllevdnrvvlpmemti
rmlvssedvlhswavpslglktdaipgrlnqttlmssrpglyygqcseicgsnhsfmpiv
lelvplkyfekwsasml

SCOPe Domain Coordinates for d5zcpo2:

Click to download the PDB-style file with coordinates for d5zcpo2.
(The format of our PDB-style files is described here.)

Timeline for d5zcpo2: