Lineage for d5zcpo1 (5zcp O:1-90)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3023860Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies)
    two antiparallel transmembrane helices
  4. 3024004Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (2 families) (S)
  5. 3024167Family f.17.2.0: automated matches [227239] (1 protein)
    not a true family
  6. 3024168Protein automated matches [226999] (2 species)
    not a true protein
  7. 3024169Species Cow (Bos taurus) [TaxId:9913] [255751] (7 PDB entries)
  8. 3024171Domain d5zcpo1: 5zcp O:1-90 [356232]
    Other proteins in same PDB: d5zcpa_, d5zcpb2, d5zcpc_, d5zcpd_, d5zcpe_, d5zcpf_, d5zcpg_, d5zcph_, d5zcpi_, d5zcpj_, d5zcpk_, d5zcpl_, d5zcpm_, d5zcpn_, d5zcpo2, d5zcpp_, d5zcpq_, d5zcpr_, d5zcps_, d5zcpt_, d5zcpu_, d5zcpv_, d5zcpw_, d5zcpx_, d5zcpy_, d5zcpz_
    automated match to d3ag3b1
    complexed with azi, cdl, chd, cu, cua, dmu, edo, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d5zcpo1

PDB Entry: 5zcp (more details), 1.65 Å

PDB Description: azide-bound cytochrome c oxidase structure determined using the crystals exposed to 20 mm azide solution for 2 days
PDB Compounds: (O:) Cytochrome c oxidase subunit 2

SCOPe Domain Sequences for d5zcpo1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5zcpo1 f.17.2.0 (O:1-90) automated matches {Cow (Bos taurus) [TaxId: 9913]}
maypmqlgfqdatspimeellhfhdhtlmivflisslvlyiislmlttklthtstmdaqe
vetiwtilpaiililialpslrilymmdei

SCOPe Domain Coordinates for d5zcpo1:

Click to download the PDB-style file with coordinates for d5zcpo1.
(The format of our PDB-style files is described here.)

Timeline for d5zcpo1: