Lineage for d5zcpl_ (5zcp L:)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2577985Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2578374Superfamily f.23.6: Mitochondrial cytochrome c oxidase subunit VIIc (aka VIIIa) [81427] (1 family) (S)
    automatically mapped to Pfam PF02935
  5. 2578375Family f.23.6.1: Mitochondrial cytochrome c oxidase subunit VIIc (aka VIIIa) [81426] (2 proteins)
  6. 2578376Protein Mitochondrial cytochrome c oxidase subunit VIIc (aka VIIIa) [81425] (1 species)
    function unknown, probably acts as a regulator or is required for the assembly
  7. 2578377Species Cow (Bos taurus) [TaxId:9913] [81424] (46 PDB entries)
  8. 3056166Domain d5zcpl_: 5zcp L: [356228]
    Other proteins in same PDB: d5zcpa_, d5zcpb1, d5zcpb2, d5zcpc_, d5zcpd_, d5zcpe_, d5zcpf_, d5zcpg_, d5zcph_, d5zcpi_, d5zcpj_, d5zcpk_, d5zcpm_, d5zcpn_, d5zcpo1, d5zcpo2, d5zcpp_, d5zcpq_, d5zcpr_, d5zcps_, d5zcpt_, d5zcpu_, d5zcpv_, d5zcpw_, d5zcpx_, d5zcpz_
    automated match to d2occl_
    complexed with azi, cdl, chd, cu, cua, dmu, edo, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d5zcpl_

PDB Entry: 5zcp (more details), 1.65 Å

PDB Description: azide-bound cytochrome c oxidase structure determined using the crystals exposed to 20 mm azide solution for 2 days
PDB Compounds: (L:) cytochrome c oxidase subunit 7c, mitochondrial

SCOPe Domain Sequences for d5zcpl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5zcpl_ f.23.6.1 (L:) Mitochondrial cytochrome c oxidase subunit VIIc (aka VIIIa) {Cow (Bos taurus) [TaxId: 9913]}
hyeegpgknipfsvenkwrllammtlffgsgfaapffivrhqllkk

SCOPe Domain Coordinates for d5zcpl_:

Click to download the PDB-style file with coordinates for d5zcpl_.
(The format of our PDB-style files is described here.)

Timeline for d5zcpl_:

  • d5zcpl_ appears in periodic updates to SCOPe 2.07 starting on 2018-08-16