![]() | Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
![]() | Superfamily f.23.2: Mitochondrial cytochrome c oxidase subunit VIa [81411] (1 family) ![]() automatically mapped to Pfam PF02046 |
![]() | Family f.23.2.1: Mitochondrial cytochrome c oxidase subunit VIa [81410] (2 proteins) |
![]() | Protein Mitochondrial cytochrome c oxidase subunit VIa [81409] (1 species) probably responsible for the dimerization of the mitochondrial cytochrome c oxidase |
![]() | Species Cow (Bos taurus) [TaxId:9913] [81408] (51 PDB entries) |
![]() | Domain d5z84g_: 5z84 G: [356227] Other proteins in same PDB: d5z84a_, d5z84b1, d5z84b2, d5z84c_, d5z84d_, d5z84e_, d5z84f_, d5z84h_, d5z84i_, d5z84j_, d5z84k_, d5z84l_, d5z84m_, d5z84n_, d5z84o1, d5z84o2, d5z84p_, d5z84q_, d5z84r_, d5z84s_, d5z84u_, d5z84v_, d5z84w_, d5z84x_, d5z84y_, d5z84z_ automated match to d3ag3g_ complexed with azi, cdl, chd, cu, cua, dmu, edo, hea, mg, na, pek, pgv, psc, tgl, unx, zn |
PDB Entry: 5z84 (more details), 1.85 Å
SCOPe Domain Sequences for d5z84g_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5z84g_ f.23.2.1 (G:) Mitochondrial cytochrome c oxidase subunit VIa {Cow (Bos taurus) [TaxId: 9913]} asaakgdhggtgartwrfltfglalpsvalctlnswlhsghrerpafipyhhlrirtkpf swgdgnhtffhnprvnplptgyek
Timeline for d5z84g_:
![]() Domains from other chains: (mouse over for more information) d5z84a_, d5z84b1, d5z84b2, d5z84c_, d5z84d_, d5z84e_, d5z84f_, d5z84h_, d5z84i_, d5z84j_, d5z84k_, d5z84l_, d5z84m_, d5z84n_, d5z84o1, d5z84o2, d5z84p_, d5z84q_, d5z84r_, d5z84s_, d5z84t_, d5z84u_, d5z84v_, d5z84w_, d5z84x_, d5z84y_, d5z84z_ |