SCOPe 2.07: Domain d5zcoq_: 5zco Q:

Lineage for d5zcoq_ (5zco Q:)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold

4. Superfamily f.23.1: Mitochondrial cytochrome c oxidase subunit IV [81406] (1 family)
   automatically mapped to Pfam PF02936

5. Family f.23.1.1: Mitochondrial cytochrome c oxidase subunit IV [81405] (2 proteins)

6. Protein automated matches [190270] (1 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [187062] (25 PDB entries)

8. Domain d5zcoq_: 5zco Q: [356218]
   Other proteins in same PDB: d5zcoa_, d5zcob1, d5zcob2, d5zcoc_, d5zcoe_, d5zcof_, d5zcog_, d5zcoh_, d5zcoi_, d5zcoj_, d5zcok_, d5zcol_, d5zcom_, d5zcon_, d5zcoo1, d5zcoo2, d5zcop_, d5zcor_, d5zcos_, d5zcot_, d5zcou_, d5zcov_, d5zcow_, d5zcox_, d5zcoy_, d5zcoz_
   automated match to d1v54d_
   complexed with azi, cdl, chd, cu, cua, dmu, edo, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d5zcoq_

PDB Entry: 5zco, 1.9 Å

PDB Description: azide-bound cytochrome c oxidase structure determined using the crystals exposed to 2 mm azide solution for 2 days

PDB Compounds: (Q:) cytochrome c oxidase subunit 4 isoform 1, mitochondrial

SCOPe Domain Sequences for d5zcoq_:

Sequence; same for both SEQRES and ATOM records:

>d5zcoq_ f.23.1.1 (Q:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
svvksedyalpsyvdrrdyplpdvahvknlsasqkalkekekaswsslsidekvelyrlk
fkesfaemnrstnewktvvgaamffigftallliwekhyvygpiphtfeeewvakqtkrm
ldmkvapiqgfsakwdydknewkk

Timeline for d5zcoq_:

• d5zcoq_ is new in SCOPe 2.07-stable
  
• d5zcoq_ appears in the current release, SCOPe 2.08