Lineage for d5zcpe_ (5zcp E:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2338494Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2340249Superfamily a.118.11: Cytochrome c oxidase subunit E [48479] (2 families) (S)
    automatically mapped to Pfam PF02284
  5. 2340250Family a.118.11.1: Cytochrome c oxidase subunit E [48480] (2 proteins)
  6. 2340251Protein Cytochrome c oxidase subunit E [48481] (1 species)
  7. 2340252Species Cow (Bos taurus) [TaxId:9913] [48482] (49 PDB entries)
  8. 2340283Domain d5zcpe_: 5zcp E: [356211]
    Other proteins in same PDB: d5zcpa_, d5zcpb1, d5zcpb2, d5zcpc_, d5zcpd_, d5zcpf_, d5zcpg_, d5zcph_, d5zcpi_, d5zcpj_, d5zcpk_, d5zcpl_, d5zcpm_, d5zcpn_, d5zcpo1, d5zcpo2, d5zcpp_, d5zcpq_, d5zcps_, d5zcpt_, d5zcpu_, d5zcpv_, d5zcpw_, d5zcpx_, d5zcpy_, d5zcpz_
    automated match to d1ocre_
    complexed with azi, cdl, chd, cu, cua, dmu, edo, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d5zcpe_

PDB Entry: 5zcp (more details), 1.65 Å

PDB Description: azide-bound cytochrome c oxidase structure determined using the crystals exposed to 20 mm azide solution for 2 days
PDB Compounds: (E:) cytochrome c oxidase subunit 5a, mitochondrial

SCOPe Domain Sequences for d5zcpe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5zcpe_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]}
hetdeefdarwvtyfnkpdidawelrkgmntlvgydlvpepkiidaalracrrlndfasa
vrilevvkdkagphkeiypyviqelrptlnelgistpeelgldkv

SCOPe Domain Coordinates for d5zcpe_:

Click to download the PDB-style file with coordinates for d5zcpe_.
(The format of our PDB-style files is described here.)

Timeline for d5zcpe_: