SCOPe 2.08: Domain d6eync2: 6eyn C:111-212

Lineage for d6eync2 (6eyn C:111-212)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d6eync2: 6eyn C:111-212 [356181]
   Other proteins in same PDB: d6eyna1, d6eynb1, d6eynb2, d6eync1, d6eynd1, d6eynd2, d6eynh1, d6eynh2, d6eynl1
   automated match to d1dn0a2
   complexed with edo, peg, so4

Details for d6eync2

PDB Entry: 6eyn, 2.4 Å

PDB Description: structure of the 8d6 (anti-ige) fab

PDB Compounds: (C:) 8D6 Fab light chain

SCOPe Domain Sequences for d6eync2:

Sequence, based on SEQRES records:

>d6eync2 b.1.1.2 (C:111-212) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtks

Sequence, based on observed residues (ATOM records):

>d6eync2 b.1.1.2 (C:111-212) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdetasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskds
tyslsstltlskadyekhkvyacevthqglsspvtks

Timeline for d6eync2:

• d6eync2 first appeared in SCOPe 2.07