Lineage for d6ezya2 (6ezy A:81-212)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712830Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2712831Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2713795Family a.45.1.0: automated matches [227130] (1 protein)
    not a true family
  6. 2713796Protein automated matches [226831] (73 species)
    not a true protein
  7. 2714244Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [324612] (22 PDB entries)
  8. 2714305Domain d6ezya2: 6ezy A:81-212 [356173]
    Other proteins in same PDB: d6ezya1, d6ezyb1
    automated match to d1aw9a1
    complexed with br, gol, gs8, gsh

Details for d6ezya2

PDB Entry: 6ezy (more details), 2.35 Å

PDB Description: arabidopsis thaliana gstf9, gsh and gsoh bound
PDB Compounds: (A:) Glutathione S-transferase F9

SCOPe Domain Sequences for d6ezya2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ezya2 a.45.1.0 (A:81-212) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
gpdllgktvedrgqveqwldveattyhppllnltlhimfasvmgfpsdeklikeseekla
gvldvyeahlskskylagdfvsladlahlpftdylvgpigkaymikdrkhvsawwddiss
rpawketvakys

SCOPe Domain Coordinates for d6ezya2:

Click to download the PDB-style file with coordinates for d6ezya2.
(The format of our PDB-style files is described here.)

Timeline for d6ezya2:

View in 3D
Domains from same chain:
(mouse over for more information)
d6ezya1