Lineage for d5z84r_ (5z84 R:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2332674Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2334266Superfamily a.118.11: Cytochrome c oxidase subunit E [48479] (1 family) (S)
    automatically mapped to Pfam PF02284
  5. 2334267Family a.118.11.1: Cytochrome c oxidase subunit E [48480] (2 proteins)
  6. 2334268Protein Cytochrome c oxidase subunit E [48481] (1 species)
  7. 2334269Species Cow (Bos taurus) [TaxId:9913] [48482] (46 PDB entries)
  8. 3056104Domain d5z84r_: 5z84 R: [356166]
    Other proteins in same PDB: d5z84a_, d5z84b1, d5z84b2, d5z84c_, d5z84d_, d5z84f_, d5z84g_, d5z84h_, d5z84i_, d5z84j_, d5z84k_, d5z84l_, d5z84m_, d5z84n_, d5z84o1, d5z84o2, d5z84p_, d5z84q_, d5z84s_, d5z84t_, d5z84u_, d5z84v_, d5z84w_, d5z84x_, d5z84y_, d5z84z_
    automated match to d1ocre_
    complexed with azi, cdl, chd, cu, cua, dmu, edo, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d5z84r_

PDB Entry: 5z84 (more details), 1.85 Å

PDB Description: the structure of azide-bound cytochrome c oxidase determined using the crystals exposed to 20 mm azide solution for 4 days
PDB Compounds: (R:) cytochrome c oxidase subunit 5a, mitochondrial

SCOPe Domain Sequences for d5z84r_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5z84r_ a.118.11.1 (R:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]}
hetdeefdarwvtyfnkpdidawelrkgmntlvgydlvpepkiidaalracrrlndfasa
vrilevvkdkagphkeiypyviqelrptlnelgistpeelgldkv

SCOPe Domain Coordinates for d5z84r_:

Click to download the PDB-style file with coordinates for d5z84r_.
(The format of our PDB-style files is described here.)

Timeline for d5z84r_:

  • d5z84r_ appears in periodic updates to SCOPe 2.07 starting on 2018-08-16