Lineage for d5zcpf_ (5zcp F:)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2587435Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 2587651Superfamily g.41.5: Rubredoxin-like [57802] (4 families) (S)
  5. 2587816Family g.41.5.3: Cytochrome c oxidase Subunit F [57818] (2 proteins)
    membrane-anchored rubredoxin-like domain
    automatically mapped to Pfam PF01215
  6. 2587817Protein Cytochrome c oxidase Subunit F [57819] (1 species)
  7. 2587818Species Cow (Bos taurus) [TaxId:9913] [57820] (45 PDB entries)
  8. 3056090Domain d5zcpf_: 5zcp F: [356152]
    Other proteins in same PDB: d5zcpa_, d5zcpb1, d5zcpb2, d5zcpc_, d5zcpd_, d5zcpe_, d5zcpg_, d5zcph_, d5zcpi_, d5zcpj_, d5zcpk_, d5zcpl_, d5zcpm_, d5zcpn_, d5zcpo1, d5zcpo2, d5zcpp_, d5zcpq_, d5zcpr_, d5zcpt_, d5zcpu_, d5zcpv_, d5zcpw_, d5zcpx_, d5zcpy_, d5zcpz_
    automated match to d3ag3f_
    complexed with azi, cdl, chd, cu, cua, dmu, edo, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d5zcpf_

PDB Entry: 5zcp (more details), 1.65 Å

PDB Description: azide-bound cytochrome c oxidase structure determined using the crystals exposed to 20 mm azide solution for 2 days
PDB Compounds: (F:) cytochrome c oxidase subunit 5b, mitochondrial

SCOPe Domain Sequences for d5zcpf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5zcpf_ g.41.5.3 (F:) Cytochrome c oxidase Subunit F {Cow (Bos taurus) [TaxId: 9913]}
asgggvptdeeqatglerevmlaarkgqdpynilapkatsgtkedpnlvpsitnkrivgc
iceednstviwfwlhkgeaqrcpscgthyklvphqlah

SCOPe Domain Coordinates for d5zcpf_:

Click to download the PDB-style file with coordinates for d5zcpf_.
(The format of our PDB-style files is described here.)

Timeline for d5zcpf_:

  • d5zcpf_ appears in periodic updates to SCOPe 2.07 starting on 2018-08-16