Lineage for d5zcpz_ (5zcp Z:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2630215Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2630850Superfamily f.23.7: Mitochondrial cytochrome c oxidase subunit VIIIb (aka IX) [81431] (1 family) (S)
    automatically mapped to Pfam PF02285
  5. 2630851Family f.23.7.1: Mitochondrial cytochrome c oxidase subunit VIIIb (aka IX) [81430] (2 proteins)
  6. 2630906Protein automated matches [190273] (1 species)
    not a true protein
  7. 2630907Species Cow (Bos taurus) [TaxId:9913] [187065] (25 PDB entries)
  8. 2630928Domain d5zcpz_: 5zcp Z: [356151]
    Other proteins in same PDB: d5zcpa_, d5zcpb1, d5zcpb2, d5zcpc_, d5zcpd_, d5zcpe_, d5zcpf_, d5zcpg_, d5zcph_, d5zcpi_, d5zcpj_, d5zcpk_, d5zcpl_, d5zcpn_, d5zcpo1, d5zcpo2, d5zcpp_, d5zcpq_, d5zcpr_, d5zcps_, d5zcpt_, d5zcpu_, d5zcpv_, d5zcpw_, d5zcpx_, d5zcpy_
    automated match to d1v54m_
    complexed with azi, cdl, chd, cu, cua, dmu, edo, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d5zcpz_

PDB Entry: 5zcp (more details), 1.65 Å

PDB Description: azide-bound cytochrome c oxidase structure determined using the crystals exposed to 20 mm azide solution for 2 days
PDB Compounds: (Z:) cytochrome c oxidase subunit 8b, mitochondrial

SCOPe Domain Sequences for d5zcpz_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5zcpz_ f.23.7.1 (Z:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
itakpaktptspkeqaiglsvtflsfllpagwvlyhldnykks

SCOPe Domain Coordinates for d5zcpz_:

Click to download the PDB-style file with coordinates for d5zcpz_.
(The format of our PDB-style files is described here.)

Timeline for d5zcpz_: