Lineage for d5z86a_ (5z86 A:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3026966Fold f.24: Cytochrome c oxidase subunit I-like [81443] (1 superfamily)
    12 transmembrane helices in an approximate threefold rotational symmetric arrangement
  4. 3026967Superfamily f.24.1: Cytochrome c oxidase subunit I-like [81442] (1 family) (S)
  5. 3026968Family f.24.1.1: Cytochrome c oxidase subunit I-like [81441] (5 proteins)
    the largest and best conserved subunit, contains two heme groups, low spin heme a and high spin heme a3
  6. 3027023Protein Mitochondrial cytochrome c oxidase, subunit I [81433] (1 species)
  7. 3027024Species Cow (Bos taurus) [TaxId:9913] [81432] (40 PDB entries)
  8. 3027057Domain d5z86a_: 5z86 A: [356133]
    Other proteins in same PDB: d5z86b1, d5z86b2, d5z86c_, d5z86d_, d5z86e_, d5z86f_, d5z86g_, d5z86h_, d5z86i_, d5z86j_, d5z86k_, d5z86l_, d5z86m_, d5z86o1, d5z86o2, d5z86p_, d5z86q_, d5z86r_, d5z86s_, d5z86t_, d5z86u_, d5z86v_, d5z86w_, d5z86x_, d5z86y_, d5z86z_
    automated match to d1v54a_
    complexed with azi, cdl, chd, cu, cua, dmu, edo, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d5z86a_

PDB Entry: 5z86 (more details), 1.85 Å

PDB Description: azide-bound cytochrome c oxidase structure determined using the crystals exposed to 20 mm azide solution for 3 days
PDB Compounds: (A:) Cytochrome c oxidase subunit 1

SCOPe Domain Sequences for d5z86a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5z86a_ f.24.1.1 (A:) Mitochondrial cytochrome c oxidase, subunit I {Cow (Bos taurus) [TaxId: 9913]}
mfinrwlfstnhkdigtlyllfgawagmvgtalslliraelgqpgtllgddqiynvvvta
hafvmiffmvmpimiggfgnwlvplmigapdmafprmnnmsfwllppsfllllassmvea
gagtgwtvypplagnlahagasvdltifslhlagvssilgainfittiinmkppamsqyq
tplfvwsvmitavllllslpvlaagitmlltdrnlnttffdpagggdpilyqhlfwffgh
pevyililpgfgmishivtyysgkkepfgymgmvwammsigflgfivwahhmftvgmdvd
trayftsatmiiaiptgvkvfswlatlhggnikwspammwalgfiflftvggltgivlan
ssldivlhdtyyvvahfhyvlsmgavfaimggfvhwfplfsgytlndtwakihfaimfvg
vnmtffpqhflglsgmprrysdypdaytmwntissmgsfisltavmlmvfiiweafaskr
evltvdltttnlewlngcpppyhtfeeptyvnlk

SCOPe Domain Coordinates for d5z86a_:

Click to download the PDB-style file with coordinates for d5z86a_.
(The format of our PDB-style files is described here.)

Timeline for d5z86a_: