Class b: All beta proteins [48724] (180 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold |
Family b.82.2.0: automated matches [191672] (1 protein) not a true family |
Protein automated matches [191281] (21 species) not a true protein |
Species Sphingobium herbicidovorans [TaxId:1219045] [355990] (2 PDB entries) |
Domain d6d1og_: 6d1o G: [356080] automated match to d1otja_ |
PDB Entry: 6d1o (more details), 2.7 Å
SCOPe Domain Sequences for d6d1og_:
Sequence, based on SEQRES records: (download)
>d6d1og_ b.82.2.0 (G:) automated matches {Sphingobium herbicidovorans [TaxId: 1219045]} rferiavqpltgvlgaeitgvdlreplddstwneildafhtyqviyfpgqaitneqhiaf srrfgpvdpvpllksiegypevqmirreanesgrvigenwhtdstfldappaavvmyake ippyggdtlftsmytawetlsptmqatieglnvvhsatrvfgslyqaqnrrfsntsvkvm dvdagdretvhplvvthpetgrkglyvnqvycqriegmsekesepllsflfahatkpeft crvrwqegdvlvwdnlctqhyavpdyagkfryltrttvggvrpar
>d6d1og_ b.82.2.0 (G:) automated matches {Sphingobium herbicidovorans [TaxId: 1219045]} rferiavqpltgvlgaeitgvdlreplddstwneildafhtyqviyfpgqaitneqhiaf srrfgpvdpvpllksiegypevqmirreanesgrvigenwhtdstfldappaavvmyake ippyggdtlftsmytawetlsptmqatieglnvvhsatrvfgslyqaqnrdvdagdretv hplvvthpetgrkglyvnqvycqriegmsekesepllsflfahatkpeftcrvrwqegdv lvwdnlctqhyavpdyagkfryltrttvggvrpar
Timeline for d6d1og_: