Class b: All beta proteins [48724] (180 folds) |
Fold b.77: beta-Prism I [51091] (4 superfamilies) consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis duplication: has internal pseudo threefold symmetry |
Superfamily b.77.3: Mannose-binding lectins [51101] (2 families) |
Family b.77.3.0: automated matches [191397] (1 protein) not a true family |
Protein automated matches [190516] (5 species) not a true protein |
Species Pineapple (Ananas comosus) [TaxId:4615] [356037] (3 PDB entries) |
Domain d6flza_: 6flz A: [356056] automated match to d5gvya_ complexed with cit, mma |
PDB Entry: 6flz (more details), 1.9 Å
SCOPe Domain Sequences for d6flza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6flza_ b.77.3.0 (A:) automated matches {Pineapple (Ananas comosus) [TaxId: 4615]} sglvklglwggnegtlqdidghptrltkivirsahaidalqfdyvedgktfaagqwggng gksdtiefqpgeyliaikgttgalgavtnlvrsltfisnmrtygpfglehgtpfsvpvas grivafygrfgslvdafgiylmpy
Timeline for d6flza_: